Protein Info for PS417_17870 in Pseudomonas simiae WCS417

Annotation: homoprotocatechuate degradative operon repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR02337: homoprotocatechuate degradation operon regulator, HpaR" amino acids 7 to 135 (129 residues), 178.5 bits, see alignment E=2.4e-57 PF12802: MarR_2" amino acids 30 to 89 (60 residues), 33.6 bits, see alignment E=3.4e-12 PF01047: MarR" amino acids 32 to 90 (59 residues), 54.3 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 47% identical to HPCR_SHIFL: Homoprotocatechuate degradative operon repressor (hpcR) from Shigella flexneri

KEGG orthology group: None (inferred from 83% identity to pba:PSEBR_a2736)

Predicted SEED Role

"5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation (EC 4.1.1.68)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.68

Use Curated BLAST to search for 4.1.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3M9 at UniProt or InterPro

Protein Sequence (142 amino acids)

>PS417_17870 homoprotocatechuate degradative operon repressor (Pseudomonas simiae WCS417)
MLKPRQSLTLTLLQAREAAMSFFRPSLNEHGLTEQQWRIIRILEQYGELEIYQLAELACI
LKPSMTGVLVRMETAGMVHRRKAEQDQRRVLVTLADKGKASFESMSQCMEANYQRLQDQL
GEEKLQTLLGLLDDLKNINIKR