Protein Info for PS417_17865 in Pseudomonas simiae WCS417
Annotation: 2-keto-3-deoxy-L-rhamnonate aldolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 66% identical to HPCH_KLEP3: 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase (hpcH) from Klebsiella pneumoniae (strain 342)
KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 85% identity to ppg:PputGB1_3503)MetaCyc: 67% identical to 4-hydroxy-2-ketopimelate aldolase monomer (Escherichia coli C)
4-HYDROXY-2-KETOPIMELATE-LYSIS-RXN [EC: 4.1.2.52]
Predicted SEED Role
"2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)" (EC 4.1.2.n4)
MetaCyc Pathways
- 4-hydroxyphenylacetate degradation (5/8 steps found)
KEGG Metabolic Maps
- Fructose and mannose metabolism
- Lysine degradation
- Naphthalene and anthracene degradation
- Pentose phosphate pathway
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Tyrosine metabolism
- alpha-Linolenic acid metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.2.- or 4.1.2.52 or 4.1.2.n4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U8W8 at UniProt or InterPro
Protein Sequence (266 amino acids)
>PS417_17865 2-keto-3-deoxy-L-rhamnonate aldolase (Pseudomonas simiae WCS417) MDMPVNRFKQRLRNGEVQIGLWLGLADAYCAELAANAGFDWLLIDGEHAPNHLQGMLAQL QAVAPYPSQALIRPVIGDSALIKQLLDIGAQTLLVPMVESAAQARELVRAMRYPPEGIRG VGSALARASRWNSIQGYLDQADDQMCLLVQIENLEGLANLDEIAAVEGVDGVFIGPADLS ASMGHRGNPGHPEVQVAIEDAIGRIVQSGKAAGILSADENLARRYIELGATFVAVGVDTT VLMRGLQALAGKFKGVPTPTHAGSVY