Protein Info for GFF3487 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 4 to 200 (197 residues), 123 bits, see alignment E=6.7e-40 PF01914: MarC" amino acids 6 to 206 (201 residues), 147 bits, see alignment E=2.5e-47

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 40% identity to sno:Snov_1678)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>GFF3487 hypothetical protein (Xanthobacter sp. DMC5)
MIDDLNLFASQLVTLWVVLEPLSHLSMFLATTSHLDRQERHKVAAMGTAFAFLILVVFTL
LGRMLLEAMGISILAFQISGGIILFYFSMTMIFGAMTQHAVTADPERRLVHIAVYPIATP
IVAGPGAILAMVLFSDNNRGAPLSQHLITVSVLVLMSVVLFVIFWLGDYIAKVLGEGGAS
LLRRIMGILLAAFSVNLVLNAFQKWLNLPPI