Protein Info for PS417_17855 in Pseudomonas simiae WCS417

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 392 (363 residues), 176.9 bits, see alignment E=2.8e-56 amino acids 284 to 424 (141 residues), 38.6 bits, see alignment E=3.3e-14

Best Hits

KEGG orthology group: None (inferred from 85% identity to pba:PSEBR_a2739)

Predicted SEED Role

"4-hydroxyphenylacetate symporter, major facilitator superfamily (MFS)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBZ0 at UniProt or InterPro

Protein Sequence (434 amino acids)

>PS417_17855 major facilitator transporter (Pseudomonas simiae WCS417)
MSTAQSTASRVLAEHDRTHRSVTWRLMPLLLVCYLFAHLDRINIGFAKMQMSSDLHFSDT
VYGFGAGLFFIAYALFGVPSNMALDRVGPRRWIASLMVVWGLLSTGMLWVESARGFYVLR
FLLGMAEAGFFPGILVFLNRWYPARRRAQVTALFAIAVPMAGVLGGPLSGAILEHFHDVG
SLRGWQWMFLIEGLPVVLLGLVVLKWLPDGFDSVHWLTAEQKRQLQTQLRSEEQRKTITS
FGGILRDPQVWLLVAVYFAVMLAVNTLAFWMPTLIHGAGIGRDSQVGLLSALPYLAGCFF
MIGCGRSSDRHRERRWHLCVPLLMAAVGIAVAGLAPGNPLLVMGGLIVAGMGASAALPMF
WQLPPAFLSNTTQAAGIAMISSFGSIAAFLAPYLIGWMRDATQSASLALYVLAVFIALGG
LLVLRTHAAIVNPR