Protein Info for GFF3484 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Mobile element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF05598: DUF772" amino acids 31 to 126 (96 residues), 88 bits, see alignment E=9.8e-29 PF01609: DDE_Tnp_1" amino acids 154 to 321 (168 residues), 106.3 bits, see alignment E=3.6e-34 PF13359: DDE_Tnp_4" amino acids 176 to 305 (130 residues), 29.2 bits, see alignment E=1.3e-10 PF13612: DDE_Tnp_1_3" amino acids 183 to 304 (122 residues), 38.9 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: None (inferred from 88% identity to pol:Bpro_5532)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF3484 Mobile element protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MYRDTRDTKVKMKQQTLAMAADQGDGYEQYRKLTKRDTFLATMEQIVPWQELCSVIEPHY
PKAGNGRPPIGLERMLRMYFVQHWFNLADEACEEALLDSTALRRFVGIDLGRERVPDGTT
LLKFRRLLEKHKLGEALFAKVGEVLQARGMKVGTGTIVDATIIGAPSSTKNADKQRDPEM
HQTRKGQQWYFGMKMHIGVDSRTGLAHSAVVTAANVHDKHPLPELLHGNEQRVYGDSAYA
SQRALIESKAPQAKDFTNQRVRRDGEIDEVERSKNHNKSKVRARVEHVFAVVKRLWGFAK
VRYRGLAKNATRSFVVLGLANIYLARQRLAA