Protein Info for GFF3482 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 80 (46 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 142 to 157 (16 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 214 to 238 (25 residues), see Phobius details amino acids 251 to 275 (25 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 34 to 298 (265 residues), 113.5 bits, see alignment E=5.2e-37

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 96% identity to vpe:Varpa_0160)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF3482 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MKALTVSPAQLRAAEAVFWIALASSFFLLPDKLTLMSQIMIFGLFAVSLDMALGYAGILT
VGHAAFFGAGAYAAGLLAKYGWSEPFTGLLFALVVSGLLGYALSYLVVRGADLTRLMITI
GVCVLLFEVANRLSGITGGTDGLQGVVIAPVLGFFDFDLYGKTAFCYAFGVVLAMFLLVR
LVLRSPFGLALRGIHDSRKRMLAIGSPVEARLRMAYAFSAAVAGVAGALLAQTTQFVGIE
SIGFNRSAEVLIILVLGGTGRLYGGMIGAIVYMLVHDWFADMNPQYWMFWLGIFLIAAVM
LGRGGIMGALSRFVRTGKAR