Protein Info for GFF348 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Xyloside transporter XynT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 110 to 137 (28 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 295 to 313 (19 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 362 to 386 (25 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 11 to 444 (434 residues), 497.6 bits, see alignment E=1.4e-153 PF13347: MFS_2" amino acids 13 to 427 (415 residues), 300.6 bits, see alignment E=7.7e-94

Best Hits

Swiss-Prot: 91% identical to YICJ_ECOLI: Inner membrane symporter YicJ (yicJ) from Escherichia coli (strain K12)

KEGG orthology group: K03292, glycoside/pentoside/hexuronide:cation symporter, GPH family (inferred from 100% identity to sew:SeSA_A3957)

Predicted SEED Role

"Xyloside transporter XynT" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>GFF348 Xyloside transporter XynT (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKSEILSVKEKIGYGMGDAASHIIFDNVMLYMMFFYTDIFGIPAGFVGTMFLLARALDAI
SDPCMGLLADRTRSRWGKFRPWVLFGALPFGIVCVLAYSTPDLSLNGKMIYAAITYTLLT
LLYTVVNIPYCALGGVITNDPTQRISLQSWRFVLATAGGMLSTVLMMPLVKLIGGENKAL
GFQGGIAALSVVAFLMLAFCFFTTKERVEAPATHTSMREDLRDIWHNDQWRIVGLLTILN
ILAVCVRGGAMMYYVTWILGKPGVFVAFLTTYCVGNLIGSALAKPLTDWKCKVSVFWWTN
ALLAVISVAMFFVPMHATIAMFVFIFVIGVLHQLVTPIQWVMMSDTVDYGEWCNGKRLTG
ISFAGTLFVLKLGLALGGALIGWMLAGGGYDAAAKTQNSATISIIIALFTIVPAICYLLS
AAIAKRYYTLKSPFLKTILEQLAQGAHRNEQEFTHKELQN