Protein Info for GFF3473 in Sphingobium sp. HT1-2

Annotation: ATP synthase protein I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 transmembrane" amino acids 52 to 70 (19 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details PF09527: ATPase_gene1" amino acids 54 to 99 (46 residues), 54.7 bits, see alignment E=4.2e-19

Best Hits

KEGG orthology group: K02116, ATP synthase protein I (inferred from 84% identity to sch:Sphch_0345)

Predicted SEED Role

"ATP synthase protein I" in subsystem F0F1-type ATP synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>GFF3473 ATP synthase protein I (Sphingobium sp. HT1-2)
MVAGEPGQDPAGEDARIASLEARIAQAEHAEQVRQGTKVQQADDGSRLGNRVLAELIGGL
VGGALIGWVLDRLLGTSPWLLLVFLGLGIVAAFRNIIRLTTTKRSDQ