Protein Info for PS417_17775 in Pseudomonas simiae WCS417

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00005: ABC_tran" amino acids 22 to 166 (145 residues), 105.1 bits, see alignment E=2.4e-34

Best Hits

Swiss-Prot: 42% identical to LOLD_SHESR: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Shewanella sp. (strain MR-7)

KEGG orthology group: K02003, (no description) (inferred from 95% identity to pfs:PFLU4002)

MetaCyc: 38% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"AttE component of AttEFGH ABC transport system"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UHN2 at UniProt or InterPro

Protein Sequence (222 amino acids)

>PS417_17775 ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MLQVQGVFKSYATPQGPLAVLAGVDLHLAERSSLALMGESGSGKSTLLHLVAGLDRVDGG
SIQVGEQRLDQLSEAQLAHWRRTDIGLVFQQFNLIGSLRVDDNLAFQARLAGRFDPQWQA
QLVERLGLGDLLKRYPEQLSGGQQQRVAVGRALASRPGLLLADEPTGNLDEATSDEVLQL
LLDLLRDSPTSLLMVTHSPRIAARLDQQVVLHRGRVVPAGVA