Protein Info for GFF3471 in Pseudomonas sp. DMC3

Annotation: Multidrug transporter MdfA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 227 to 251 (25 residues), see Phobius details amino acids 264 to 281 (18 residues), see Phobius details amino acids 293 to 316 (24 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details amino acids 384 to 404 (21 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 364 (340 residues), 117.3 bits, see alignment E=7.8e-38 PF00083: Sugar_tr" amino acids 55 to 193 (139 residues), 29.2 bits, see alignment E=4.6e-11

Best Hits

KEGG orthology group: K08160, MFS transporter, DHA1 family, multidrug/chloramphenicol efflux transport protein (inferred from 73% identity to pfo:Pfl01_2560)

Predicted SEED Role

"Multidrug translocase MdfA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>GFF3471 Multidrug transporter MdfA (Pseudomonas sp. DMC3)
MQRTLINIGPRQVAGFCLALTAFELLTYMASDVIMPAMLDVTTDLQADAQHVPHAFNLYL
LGGVCLQWLLGPLSDQFGRRPLLLIGSALFGVSCAAAFSTDSIEAFNLLRLLQGMGLGFV
VAVSYPALQEVFCEADAVRLMALLGNVALLSPLLGPLLGILLLEWLSWREIFLLLGCTAA
LVWLGLLLWMPETVGVERRDGHQTRPVPFSWRLTCRRYGALLGNPRFLCASLALGLMSLP
LIAWIGLAPLLLVRVLEMPPLEYGLWQIPVFSAVIAGNLILDRLLQTHSLTQLIQLALWP
FCLGLLFLAACALLGAGLGPVVASLSLYAVGLGMSNAAVYRLALFSSDDSKGLVSALTGM
ISIAVMGFGGSLIAAIGGGSRLEYFAIWAAFGGLMCLPMVYRLLQTTTSDVASPQ