Protein Info for GFF3470 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details PF00892: EamA" amino acids 12 to 144 (133 residues), 57.1 bits, see alignment E=1.3e-19 amino acids 158 to 293 (136 residues), 59.2 bits, see alignment E=2.7e-20

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_0146)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>GFF3470 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MIQRKTHLDSLAIGLLIACCAFWGLQQILIKTTVAEVPPMWQASIRMVGATALLWLWCVW
RRVPLFERDGTLWPGLLAGLLFSGEFAGIYLGLQNTSASRLTVFLYTAPFWVSLLLPRWV
PAERLRGFQWLGLFIAFSGVVLAFSEGFGHMSSSQLVGDAMGLAAGALWGLTTLTLRTTK
LATASAEKTLFYQVAVTAAMCPLLSLALGEHWRFAYSAGAWTSIGLQTVIGAFASYLTWM
WLLRHYPATQMSSFTFLTPLFALVFGVVVLKEPLTAQLIVALIGVALGIVLVNRRPAVQR
SA