Protein Info for GFF3470 in Sphingobium sp. HT1-2

Annotation: ATP synthase F0 sector subunit b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02326: YMF19
  • amino acids 3 to 58 (56 residues), 27.7 bits, E=4e-10
• PF00430: ATP-synt_B
  • amino acids 15 to 141 (127 residues), 55.7 bits, E=5.7e-19

Best Hits

Swiss-Prot: 31% identical to ATPF2_BRADU: ATP synthase subunit b 2 (atpF2) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 88% identity to sch:Sphch_0348)

Predicted SEED Role

"ATP synthase B' chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (164 amino acids)

>GFF3470 ATP synthase F0 sector subunit b (Sphingobium sp. HT1-2)
MPQIAQIADTYASQIFWLLLTFGFVFFVIGRGMVPKVQATADARDAKISGDLDAAKAAFA
RADEAEADYRVRDAESRTAAQATLAKAKADAAKASEAKLAAADAEIQDKIGAAEARIKTA
TDAAMAQIETVAADAARDMVVRISGVEASDEAARNAVKAALAHG