Protein Info for GFF3469 in Sphingobium sp. HT1-2

Annotation: ATP synthase F0 sector subunit b (EC 3.6.3.14)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 59% identical to ATPF_SPHAL: ATP synthase subunit b (atpF) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 84% identity to sjp:SJA_C1-22610)

Predicted SEED Role

"ATP synthase F0 sector subunit b"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>GFF3469 ATP synthase F0 sector subunit b (EC 3.6.3.14) (Sphingobium sp. HT1-2)
MAEAAVEHSEAQAPHLNQAIHAEGMEPVGTVAHEGVAPHTDPKAVGMDATAWVSLAMAVF
IVILLIKKVPSLIGGVLDGRIAQIKEQLAEASKLRAEAEALKGEYEAKLAAAAGEADAMR
KSAEHEAETLLSDAKVQAADLVARRQKMAEDKIGAAERSALADIRAKAVKAATGAAAALI
AEGHDAKADKALVDDAIKGLGPVA