Protein Info for GFF3468 in Xanthobacter sp. DMC5

Annotation: Ferrous iron permease EfeU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 113 to 138 (26 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details PF03239: FTR1" amino acids 1 to 260 (260 residues), 122.1 bits, see alignment E=1.4e-39

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 84% identity to xau:Xaut_3198)

Predicted SEED Role

"High-affinity Fe2+/Pb2+ permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>GFF3468 Ferrous iron permease EfeU (Xanthobacter sp. DMC5)
MIAALLIVFREVLEAGIVTGVVLAASEGIRHRGLWISLGILGGVAGSAVLALFADTIAST
FDGSGQDILNAAILSVAVVMLVWTVVWMASHGKHMVMEMREVGRDVKEGRKPLAALAIVV
GMAVLREGVEIVLFLYGIASTGADTPAQVALGGLAGLAGGAALSLLLYRGLVAIPLKHLF
KVTSVLITLLAAGLAAQVVGILQDSGFIQSLADPVWNSSWLLADDSALGRVLRTLIGYRA
EPTGMQVIAYAATVVVILGLSAIVNGRLSAAPRRQGAGHSAGGHVSRA