Protein Info for GFF3464 in Xanthobacter sp. DMC5

Annotation: Molybdate-binding protein ModA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13531: SBP_bac_11" amino acids 32 to 262 (231 residues), 183.3 bits, see alignment E=6.2e-58 PF01547: SBP_bac_1" amino acids 37 to 255 (219 residues), 70.1 bits, see alignment E=3.4e-23 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 37 to 261 (225 residues), 195 bits, see alignment E=8.2e-62

Best Hits

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 77% identity to xau:Xaut_3202)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>GFF3464 Molybdate-binding protein ModA (Xanthobacter sp. DMC5)
MSGFIASRRLILGLVFSAFAAAPLPAAAQETVTVFAAASLTNALQDIAKAYEAQGSKGGN
KDSIKFSFAASSALAKQMEAGAPANIFASADLKWMDYTDGKGLTLPATRVKLLGNELVLV
APADKAKPVTISKSLDVDALLGPNGRIATGLTDSVPVGVYTKQAFTNLGLWDKIAPRIVG
AESVRAALALVERGEVPYGVVYATDAAIAKNVKVVATFPADSYPPVDYPFALVKGQDTPA
AKAFFAFVQSPEAKAIFKKYGFSVN