Protein Info for GFF3463 in Variovorax sp. SCN45

Annotation: Urea ABC transporter, permease protein UrtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 8 to 299 (292 residues), 388.2 bits, see alignment E=1.6e-120 PF02653: BPD_transp_2" amino acids 10 to 286 (277 residues), 138.3 bits, see alignment E=1.4e-44

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 93% identity to vei:Veis_4909)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF3463 Urea ABC transporter, permease protein UrtB (Variovorax sp. SCN45)
MNFDIAVMQVFNGVSLFTILLLMAIGLAIVFGLMGVINMAHGELMALGAYMTYLAARFFE
HFAPGFMDLYLFAAIPFAFAVTFAFGYVLERGFIRFFYDRPLDTLLATWGLSLMLQQAYR
SIFGAQEVSVPLASWLAGAWEPTAGIQLPLNRIFIVGLTALVATGVYLLLYRTSWGLKVR
AVTQNRAIAGAVGIDTHRVDAMTFALGSGLAGIAGAVFTMIGSTNPGTGQLYIVDSFIVV
VFGGVQSLVGTALSGFSIAQSQTWLEYLMSGSMAKATILLLVIVVLYFRPNGLFATRSRS