Protein Info for GFF3463 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 43 to 59 (17 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details PF00015: MCPsignal" amino acids 308 to 464 (157 residues), 75.8 bits, see alignment E=1.9e-25

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>GFF3463 hypothetical protein (Sphingobium sp. HT1-2)
MNVERPMESIRLAGARMLMWLFWLNVPALMLIGWLLNSPDAEVGALAAALLALLPTIMVR
RRDISAPARMTLAVTSVAIPALYVFLLRGHGWQMDMHMGFFAALAAQTVLLDRRALLVAA
GVTALHHLILNYSYPAWVFASEGDLPRVLVHALIVVIQTLMLWWIVSLLTQTIRLQTEER
QRSEGLRKEADAAKERAEVALAELERAQTIATRQRAIEEAARRAEEASERRRLVADALEA
RLGAVVGDLGQLAGQLSASKQWLFDLLDRTTQRSAELRKAHARADGDVRAVAQDTEKLAI
SINGVGGSASHTRDNALRGAMATRALTPEVDMLSATVDSASSIVALISQIAAQSRTLSLN
AGIEAARSGSEVRGFAVVASEMKSLAAQTAEATRQIDIYLQDIRRAADSVSGAIDVATQS
ADTIDRSTAGIVDDVAEQIRATGEIAAATEEMARHIAEAASQAEALSLALAEAQSAMGET
DAAATALSSRSQELQETVRNVLEELRAA