Protein Info for PS417_17725 in Pseudomonas simiae WCS417

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 108 to 132 (25 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 57 to 321 (265 residues), 161.3 bits, see alignment E=1.4e-51

Best Hits

Swiss-Prot: 52% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 99% identity to pfs:PFLU3994)

MetaCyc: 47% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UN77 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PS417_17725 ribose ABC transporter permease (Pseudomonas simiae WCS417)
MQQGAQVNTSISTGDSSRLRLNLARLVRSPAFYPFVGLVVVTLVMILASDTFLTASNLSN
IARQVSINAIIAVGMTCVILTGGIDLSVGPVMALSGTLTAGLMVAGLPPGLAIGAGMLIG
VAFGIGNGLFVAYLHMPPIIVTLATMGIARGLGLMYTDGYPISGLPDWFAFFGRESLFGI
QVPILIMLLTYLVAYVLLQHTRIGRYIYAIGGNEEAVRLSGVRAARFKLLVYGISGLTAA
IAGLVLTSRLMSGQPNAGVSFELDAIAAVVLGGASIAGGRGVIVGTLLGAMLLGVLNNGL
NMLGVSPYVQSVIKGGIILLAIFISRQRHK