Protein Info for GFF3459 in Sphingobium sp. HT1-2

Annotation: DNA recombination and repair protein RecO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF11967: RecO_N" amino acids 4 to 74 (71 residues), 46 bits, see alignment E=4.5e-16 TIGR00613: DNA repair protein RecO" amino acids 6 to 180 (175 residues), 65.6 bits, see alignment E=2.2e-22 PF02565: RecO_C" amino acids 89 to 220 (132 residues), 84 bits, see alignment E=9.7e-28

Best Hits

Swiss-Prot: 69% identical to RECO_SPHWW: DNA repair protein RecO (recO) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K03584, DNA repair protein RecO (recombination protein O) (inferred from 86% identity to sch:Sphch_0370)

Predicted SEED Role

"DNA recombination and repair protein RecO" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>GFF3459 DNA recombination and repair protein RecO (Sphingobium sp. HT1-2)
MPVLITSGIVCALRAHGEHGAVARLLTPDHGLVAGYVRGGRSRALRPVLLPGNAVKAEFR
ARTEDQLASLTVELEHSRAPLLGEPLPAAAIDWACALTAAALPEGTPYPTLYEALDGVLG
AVEAAPAARGWAAALVRYELLLLAELGFGLDLSRCAATGTADDLAFVSPRSAAAVSRAGA
EGYEARLLPLPSFLLQGGAGDWPQIMDGLRLTGFFLERSVLTERRADVLAARERLVDRLK
RAVA