Protein Info for GFF3457 in Xanthobacter sp. DMC5

Annotation: Shikimate dehydrogenase (NADP(+))

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF08501: Shikimate_dh_N" amino acids 22 to 105 (84 residues), 81.4 bits, see alignment E=4.5e-27 PF01488: Shikimate_DH" amino acids 135 to 182 (48 residues), 30.5 bits, see alignment 3.5e-11

Best Hits

Swiss-Prot: 41% identical to AROE_RUBXD: Shikimate dehydrogenase (NADP(+)) (aroE) from Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 82% identity to xau:Xaut_1616)

MetaCyc: 45% identical to 5-amino-3-dehydroquinate dehydrogenase (Amycolatopsis mediterranei U32)
1.1.1.-

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>GFF3457 Shikimate dehydrogenase (NADP(+)) (Xanthobacter sp. DMC5)
MTASTTAPNPREISGLTKVYGILADPIHHVKTPQMLNALMAREGRDGVMVPFHVSSEELP
RLVDGLKAMKSLGGFVVTVPHKTAIVDLLDEVSDSARRIGACNVVRREADGRLIGDMLDG
KGFVGGLKAAGIDPKGKGVYLAGAGGAANAIAFAFVEAGVARLTIANRTRAKAEDLAARL
ADAFPGAPVEIGTADPSGHDIVANATSLGLKAGDALPLDASRLTSDQIVAEVIMQPEETA
ILAAAKAKGCRTHPGKPMLVCQLDLMADFLGMRSLGAAS