Protein Info for GFF3455 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Type IV secretion system protein VirD4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details PF02534: T4SS-DNA_transf" amino acids 117 to 566 (450 residues), 339.1 bits, see alignment E=6.7e-105 PF10412: TrwB_AAD_bind" amino acids 177 to 547 (371 residues), 99.8 bits, see alignment E=2.5e-32 PF12696: TraG-D_C" amino acids 413 to 534 (122 residues), 99 bits, see alignment E=2.9e-32

Best Hits

KEGG orthology group: K03205, type IV secretion system protein VirD4 (inferred from 85% identity to dac:Daci_2701)

Predicted SEED Role

"Type IV secretion system protein VirD4" in subsystem Type 4 secretion and conjugative transfer or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (673 amino acids)

>GFF3455 Type IV secretion system protein VirD4 (Hydrogenophaga sp. GW460-11-11-14-LB1)
VQAQGASHQGVLYGQIAAVLGVVVVGVWGATQWTAAALGHQARLGAPWFLAFDYPVYHPW
RLFEWWFFFDAYAPDVFDVGGAIAGGSGLVSVGVAVGMSVWRSRQSRLVTTYGTARWATT
DDVRRAGLNRAGGVFLGQHGEQYLRHDGPEHVLAFAPTRSGKGVGLVVPTLLSWSGSAVI
HDIKGENWQLTAGWRACFSHCLLFNPTDVRSAAYNPLLEVRRGVHEVRDVQNIADILVDP
EGALERRNHWEKTSHALLVGAILHVLYAGKDKTLRGVANFLSDPACPFEVTLHRMMSTPH
LASEQGGGPHPVVASAAREVLNKSENERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIAD
LISTEHPVSLYLVVPPSDISRTKPLIRLILNQVGRRLTESLDGSDGIARRHKLLLMLDEF
PALGRLDFFETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERT
AKRISETLGTATELRAQRNYAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVM
ISSVPPVKARKLRYYADANFKRRVLPPPLLIAGTYPDAPPVRADDWGELAVPAPPTASNP
AFMAGMDADEGGPRLQSELTEIATHNPAIDALTNDLALLDDDDAPLPLPRQLDPAMQRTA
RLAALDPDDGITL