Protein Info for GFF3453 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Periplasmic chorismate mutase I precursor (EC 5.4.99.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01806: putative chorismate mutase
  • amino acids 24 to 134 (111 residues), 119.2 bits, E=5.1e-39
• PF01817: CM_2
  • amino acids 30 to 99 (70 residues), 61 bits, E=5.1e-21

Best Hits

Swiss-Prot: 100% identical to CHMU_SALTM: Monofunctional chorismate mutase (aroQ) from Salmonella typhimurium

KEGG orthology group: K01850, chorismate mutase [EC: 5.4.99.5] (inferred from 99% identity to seh:SeHA_C1390)

Predicted SEED Role

"Periplasmic chorismate mutase I precursor (EC 5.4.99.5)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 5.4.99.5)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis III (3/4 steps found)
• L-phenylalanine biosynthesis II (2/4 steps found)
• L-tyrosine biosynthesis II (2/4 steps found)
• superpathway of L-phenylalanine and L-tyrosine biosynthesis (2/5 steps found)
• bacilysin biosynthesis (1/10 steps found)
• salinosporamide A biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.5

Use Curated BLAST to search for 5.4.99.5

Protein Sequence (181 amino acids)

>GFF3453 Periplasmic chorismate mutase I precursor (EC 5.4.99.5) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIRHIAIFLCSLLMCSTTFADSVTSVSLGALLTALNERMLLMKDVAAYKMKHHLPIEDFT
REQNVFAEAEEEAKNNGLDPHSITPFIRSLMDASKAIQYRYLAQWRTGSEPSFPIQTLSV
TRQRIRQLDNQMLIIISQRLMVGAFSHDDMVWLRAQFNAPNLNESDISNVLAALSLVRRA
R