Protein Info for GFF3449 in Variovorax sp. SCN45

Annotation: Intradiol ring-cleavage dioxygenase:Catechol dioxygenase, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04444: Dioxygenase_N
  • amino acids 23 to 95 (73 residues), 81 bits, E=4.6e-27
• PF00775: Dioxygenase_C
  • amino acids 120 to 276 (157 residues), 149.5 bits, E=7.7e-48

Best Hits

KEGG orthology group: None (inferred from 86% identity to vap:Vapar_0130)

MetaCyc: 44% identical to hydroxyquinol 1,2-dioxygenase (Rhizobium sp. MTP-10005)
Hydroxyquinol 1,2-dioxygenase. [EC: 1.13.11.37]

Predicted SEED Role

"Intradiol ring-cleavage dioxygenase:Catechol dioxygenase, N-terminal"

MetaCyc Pathways

• resorcinol degradation (2/3 steps found)
• 4-nitrophenol degradation II (3/5 steps found)
• γ-resorcylate degradation I (2/4 steps found)
• γ-resorcylate degradation II (2/4 steps found)
• 4-aminophenol degradation (2/4 steps found)
• 2,4,5-trichlorophenoxyacetate degradation (5/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.37

Use Curated BLAST to search for 1.13.11.37

Protein Sequence (288 amino acids)

>GFF3449 Intradiol ring-cleavage dioxygenase:Catechol dioxygenase, N-terminal (Variovorax sp. SCN45)
MNIATSPDSVLGHVLDAMKNTPDPRLRTVMEAVTRHLHALVQEVKLTEDEFEQALEFIVA
IGHATGETKNEVVLAADILGVSTVVALQNNQDPHGESPAALLGPFWRANAPACALGDDIA
RSGTPGTPLEVTGTVRDHEGRPVAGATVDVWQASPVGLYENQDPAQEDMNLRGRFFTDAE
GRFRFRSVRPAGYPVPTDGPCGVLLRAQVRHPNRPAHLHFMVSKPGHKVLITQVFADDDE
NLESDPTFGVTRRLIGRFALAPDGKSASMHHDFELEPGEMKFPRPPIP