Protein Info for GFF3449 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details PF16491: Peptidase_M48_N" amino acids 16 to 175 (160 residues), 77 bits, see alignment E=1.7e-25 PF01435: Peptidase_M48" amino acids 186 to 379 (194 residues), 95.8 bits, see alignment E=2.9e-31

Best Hits

KEGG orthology group: K06013, STE24 endopeptidase [EC: 3.4.24.84] (inferred from 57% identity to cak:Caul_2907)

Predicted SEED Role

"peptidase, M48 family"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>GFF3449 hypothetical protein (Sphingobium sp. HT1-2)
MAAGFNPDAATAAYLATLSPAQHERAIAYTQGGHWLLLWGMLVTLVAMALIWRSGLLVRL
GRRVHVRRPNLAVFLSALLFFLLDWLIELPWSIYANWGRERSYGLTSQGFGGWLGEDILS
SAISLPLLALLAVAIYALMRRTPRWWWAWSGLVVVLGIILMVVIAPVAIEPLFNKYTPAP
AGPARDAVVELAHRAGVPGDKIYIYDGSKQSERYTANVSGLFGTARVAMSDVMFKRGADL
AEVRGVVGHEMGHYAEHHVLWLAGSMSLLAMLLFFLVDRLYPVAARWFGAGSAISDPAHM
PIAWAVAAVVGIFLVPLMNSISRYDENAADRFSLKVAHEPDGLAKALVKTIEYRASSPSR
LEEILFYDHPSVERRIHAAMVWKAENPQLVGK