Protein Info for GFF3445 in Xanthobacter sp. DMC5

Annotation: Alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR02318: phosphonate metabolism protein PhnM" amino acids 5 to 377 (373 residues), 482.2 bits, see alignment E=5e-149 PF01979: Amidohydro_1" amino acids 48 to 377 (330 residues), 31.9 bits, see alignment E=8.6e-12 PF07969: Amidohydro_3" amino acids 250 to 377 (128 residues), 32.9 bits, see alignment E=5.4e-12

Best Hits

KEGG orthology group: K06162, PhnM protein (inferred from 86% identity to xau:Xaut_1310)

MetaCyc: 53% identical to alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (Sinorhizobium meliloti 1021)
RXN-17958 [EC: 3.6.1.63]

Predicted SEED Role

"Metal-dependent hydrolase involved in phosphonate metabolism" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>GFF3445 Alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (Xanthobacter sp. DMC5)
MRQVFANARLVLADEIVSGHVSVTDGVISAIGTGVVPAGAEDLEGDYLLPGLVELHTDHV
EGHLAPRPKVRWNPLAAMLAHDAQIAASGITTVFDSLRVWPDKKAVGMDGDAPLLIAALE
AARAADALRADHFIHLRCEVPTDTVVQDAEAILKKTPVHLISLMDHTPGQRQFATIDQFR
SYYMKKSGISAEEMDVIVTSRLDFHERYARENRAGLVALAHAHRCVVASHDDGTPEHVAE
AIGDGVAIAEFPTTELAARLSHEAGIRVLMGAPNLVRGGSHTGNVSAEELARGGRLDILS
SDYVPSSLLWAAFDLTRRVPSIALPEAVRMITKTPAEVAGLADRGEIAPGRRADLVRVAL
AGDMPVVKGVWREGRRVA