Protein Info for GFF3442 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Nickel transport system permease protein nikC2 (TC 3.A.1.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 71 to 93 (23 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 262 (179 residues), 76.2 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 98% identity to see:SNSL254_A1363)

Predicted SEED Role

"Nickel transport system permease protein nikC2 (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>GFF3442 Nickel transport system permease protein nikC2 (TC 3.A.1.5.3) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLYNPAPTLFRLLLSVTCLLFIAGYGYATLSQPPEVNLLARHLSPDIQHWFGTDNLGRDV
WLRCFQGAFTSLQIGVGAALCSGVIALVMAAVARIHPRLDLLVRLITDAMLAMPHLLLLI
LICFTLGGGKSGVIAAVALTHWPRLALILRADAERVAQSDYLTLTYRLGHGHLYCWRYHY
FPALLPQWLTGTLLMFPHAVLHSAALSFLGFGLAPHEPSLGLLLADALRFISHGNWWLVL
FPGLMLFTLVMLFDQFARAIQRLWLRSDVC