Protein Info for GFF3440 in Sphingobium sp. HT1-2

Annotation: Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01737: phosphoribosylformylglycinamidine synthase I
  • amino acids 1 to 218 (218 residues), 292.2 bits, E=1.1e-91
• PF13507: GATase_5
  • amino acids 2 to 206 (205 residues), 135.2 bits, E=2.2e-43
• PF07685: GATase_3
  • amino acids 33 to 96 (64 residues), 29.5 bits, E=5.7e-11

Best Hits

Swiss-Prot: 74% identical to PURQ_NOVAD: Phosphoribosylformylglycinamidine synthase subunit PurQ (purQ) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 92% identity to sch:Sphch_0394)

MetaCyc: 53% identical to phosphoribosylformylglycinamidine synthetase subunit I (Bacillus subtilis subtilis 168)
Phosphoribosylformylglycinamidine synthase. [EC: 6.3.5.3]

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Protein Sequence (224 amino acids)

>GFF3440 Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3) (Sphingobium sp. HT1-2)
MKSAVIVFPGSNCDRDLAVAFEAATGSKPTMVWHRDTELPDDIDLIGVPGGFSYGDYLRS
GAMAARSPVMQAVARAADRGAFVLGICNGFQVLTESGLLPGALLRNAGGHFVCRDVALTV
ENAQSAFTSRYAAGEAISFPVAHHDGNYFADDATLDRLEGEGRVALRYTQNINGSARNIA
GVLNEAGNVLGMMPHPERVIEPAHGNTDGQRLFAGLVEGLLARA