Protein Info for GFF3439 in Xanthobacter sp. DMC5

Annotation: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 TIGR03293: phosphonate C-P lyase system protein PhnG" amino acids 23 to 164 (142 residues), 140.7 bits, see alignment E=1.7e-45 PF06754: PhnG" amino acids 24 to 163 (140 residues), 156 bits, see alignment E=3.5e-50

Best Hits

Swiss-Prot: 50% identical to PHNG_RHIME: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG (phnG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06166, PhnG protein (inferred from 74% identity to xau:Xaut_1316)

Predicted SEED Role

"PhnG protein" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>GFF3439 Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG (Xanthobacter sp. DMC5)
VRSEPPRTEPQIAAVADPAAEQAAREVMMGLYARATRAELQAAVERFQPLPQLKKLRPAE
AGLIMVQGRTGGDGAPFNLGEATVTRAAVQLAGGATGVSYLLGRDPAKAEAAAILDALWQ
DAALRLAVTDALTPVRRRLAVEAAIAAEETEATKVNFFTMARGED