Protein Info for GFF3438 in Xanthobacter sp. DMC5

Annotation: HTH-type transcriptional repressor NagR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR02325: phosphonate metabolism transcriptional regulator PhnF" amino acids 10 to 243 (234 residues), 259.4 bits, see alignment E=1.6e-81 PF00392: GntR" amino acids 19 to 80 (62 residues), 72.9 bits, see alignment E=2e-24 PF07702: UTRA" amino acids 103 to 240 (138 residues), 98.7 bits, see alignment E=3.9e-32

Best Hits

Swiss-Prot: 39% identical to Y6150_RHIME: Uncharacterized HTH-type transcriptional regulator RB1450 (RB1450) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02043, GntR family transcriptional regulator, phosphonate transport system regulatory protein (inferred from 80% identity to xau:Xaut_1317)

Predicted SEED Role

"Transcriptional regulator PhnF" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>GFF3438 HTH-type transcriptional repressor NagR (Xanthobacter sp. DMC5)
MGAAPAGSVARGSGVTLWRQIAEKLEADILAGALAPGVRLPVEADLAERFGVNRHTLRRA
LSHLSEAGLIEATAGRGTFVKEPPLRYPIGPRTRFSEIVAAGGREPSGRFRGSTVEPADA
DVARELQLAIGTPVLRIETTHEADGVPISCGSAWFPAARCRDLDLIYEATGSLTRALATL
GIEDFRRRETRITARPANPREMDILSLAPGRAVMVLERLDVEANGTPLQWGRSSFAADRV
QLVFKP