Protein Info for GFF3438 in Variovorax sp. SCN45

Annotation: Amidohydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01891: amidohydrolase
  • amino acids 15 to 374 (360 residues), 363.7 bits, E=5.5e-113
• PF01546: Peptidase_M20
  • amino acids 72 to 383 (312 residues), 152.5 bits, E=1.6e-48
• PF07687: M20_dimer
  • amino acids 185 to 278 (94 residues), 42.4 bits, E=5.9e-15

Best Hits

Swiss-Prot: 38% identical to HIPO_CAMJE: Hippurate hydrolase (hipO) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K01436, amidohydrolase [EC: 3.5.1.-] (inferred from 80% identity to reh:H16_B0491)

MetaCyc: 47% identical to beta-tabtoxin peptidase (Pseudomonas syringae)
3.4.11.-

Predicted SEED Role

No annotation

MetaCyc Pathways

• tabtoxinine-β-lactam biosynthesis (4/6 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Protein Sequence (389 amino acids)

>GFF3438 Amidohydrolase family protein (Variovorax sp. SCN45)
MYRDPEIAEDTRARMLSWRRDIHANPETAFEEHRTANVVANALMLMGLPVHRGLAGTGVV
GTLKNGEGPSIALRADLDALNMQELGTQAHASKCVGKMHACGHDGHTAMLLGAAEHLSRH
KPFKGTVHFVFQPAEENEGGGRVMVEEGLFDQFPADAVYGMHNFPALPRGQFAIRKGTMT
AFLDTFEIVVTGKGSHGAMPETGIDSVVVSAQLVNALQTIVSRRTGATDSAVVSVTQIHG
GDTWNVIPETVVLRGTVRTLDAAIQDKTQAAMQQICDGVAATHGAKVALDYRRGYPGVVN
TPAETDAAVAAAASLVDRAQVKTDIPPAMGSEDFAFMLQKRPGAYIGIGAGEGPNDPNVH
NPYYDFNDNILPLGAAYWVALVKQQLPAA