Protein Info for GFF3436 in Sphingobium sp. HT1-2

Annotation: Fosmidomycin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 88 to 126 (39 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 226 to 250 (25 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 363 (337 residues), 124 bits, see alignment E=3.5e-40 amino acids 242 to 397 (156 residues), 43.9 bits, see alignment E=7.8e-16

Best Hits

KEGG orthology group: K08223, MFS transporter, FSR family, fosmidomycin resistance protein (inferred from 79% identity to swi:Swit_0720)

Predicted SEED Role

"Fosmidomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>GFF3436 Fosmidomycin resistance protein (Sphingobium sp. HT1-2)
MKEIRIEKAGAQLAAGGTAFGVIVAISFCHLLNDMMQSLLPAIYPGLKSELHLSFGQIGM
VTLVYQITASILQPMIGLYADKRPTPMALPGGTLFSLAGLTVLSIAHSYGLVLVGAALLG
VGSSVFHPESSRVARMAAGGRHGLAQSLFQVGGNAGQALGPLAAALVVVRWGQSSLAFFA
LLALLSGAVLWNVANWYRHHGLSRLQVGGAGALHVELPRGHAARGIAILLALIFSKYVYL
ASLTSYYTFYLIQRFDLSVQNAQLHLFAFLAAVAVGTVAGGPLGDRFGRKYVIWFSILGA
LPFTLALPYAGLFWSGPLTVIIGLILASAFPAIVVFAQELVPGKVGMISGLFFGFSFGMG
GLGAAGLGWLADHSSIEMVFRVCAFLPAIGLLTAFLPNLGRERN