Protein Info for GFF3436 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cytochrome C553 (soluble cytochrome f)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 46 to 63 (18 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 3 to 174 (172 residues), 86.5 bits, see alignment E=1e-28

Best Hits

Swiss-Prot: 67% identical to C56H_ECOLI: Cytochrome b561 homolog 1 (yodB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sek:SSPA1480)

Predicted SEED Role

"Cytochrome C553 (soluble cytochrome f)" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>GFF3436 Cytochrome C553 (soluble cytochrome f) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAHFSRLQITLHWLTLLLTGIAYAAIELRGWAPKGSSVYLFMKDTHYDMGVLVWALMFLR
LYLKHKYPDPVITPPPPHWQHVAAKLMHIALYLTFLALPLLGVAMMASGGKSWSFFGFTV
PVFLTPDSTLKSDIKRIHEMLANIGYFLIAMHAAAALFHHYIQKDDTFSRMLPGKS