Protein Info for GFF3435 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 102 to 127 (26 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 27 to 287 (261 residues), 284.1 bits, see alignment E=4.9e-89 PF00528: BPD_transp_1" amino acids 123 to 281 (159 residues), 75.8 bits, see alignment E=1.9e-25

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 83% identity to xau:Xaut_1320)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF3435 hypothetical protein (Xanthobacter sp. DMC5)
VSHAITRLPDEQIAPLIAHYDAAVRARRRHTLIVFGVIAVCIVLAAWMGEVKPSVFFAHA
DRLPNYFWSITPVLHWDTLGADLSEWYWNLDHWLKLLVDTIMIAYLGTLIGAIGGFCLCF
LASANLVKSPFIRLAARRFLEFCRTVPELVFALLFVVAFGLGPLPGVLALAIHTMGALGK
LFAEVVENIDMKPVEGATASGASWLTTVRFAVVPQVLSNFASYGLLRFEINVREASIMGF
VGAGGIGQDLVEAIRKFYYSDVSAILLLIITAVMIIDLVTEQVRHRLLGFGAQR