Protein Info for GFF3433 in Xanthobacter sp. DMC5

Annotation: Phosphate-import ATP-binding protein PhnC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR02315: phosphonate ABC transporter, ATP-binding protein" amino acids 1 to 242 (242 residues), 337 bits, see alignment E=3e-105 PF00005: ABC_tran" amino acids 18 to 173 (156 residues), 117.9 bits, see alignment E=2.6e-38

Best Hits

Swiss-Prot: 77% identical to PHNC_RHOPS: Phosphonates import ATP-binding protein PhnC (phnC) from Rhodopseudomonas palustris (strain BisB5)

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 92% identity to xau:Xaut_1322)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>GFF3433 Phosphate-import ATP-binding protein PhnC (Xanthobacter sp. DMC5)
MLVIEGLTRRFGDKEAVSNVNLAIGQGAFVGVIGRSGAGKSTLLRMVNRLQDPSSGRISF
DGRDVTALKGHALRQWRAEAAMIFQQFNLVGRLDVLTNVLMGRLATVPAWRALTKSWSAD
DRAIALSALDQFDIAPLAAQRADSLSGGQQQRVAIARALAQEPALILADEPIASLDPRNT
KIVMDALLRINKHFGITVLCNLHSLDLARTYCDRLVGMAQGRVVFDGAPAALTEQVAHDL
YGLEAGEVMDTPARRPVAANDGIPEAAALA