Protein Info for GFF3430 in Xanthobacter sp. DMC5

Annotation: L-serine dehydratase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF03315: SDH_beta" amino acids 3 to 150 (148 residues), 180.1 bits, see alignment E=3.8e-57 TIGR00720: L-serine ammonia-lyase" amino acids 3 to 445 (443 residues), 623 bits, see alignment E=1.7e-191 PF03313: SDH_alpha" amino acids 178 to 442 (265 residues), 290 bits, see alignment E=2e-90

Best Hits

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 86% identity to xau:Xaut_0871)

Predicted SEED Role

"L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>GFF3430 L-serine dehydratase 2 (Xanthobacter sp. DMC5)
MTSVFDLFKIGIGPSSSHTVGPMVAARRFREALPAGTARITAELFGSLAWTGKGHGSNRA
IALGLMGARPETLDPDDVPALVARLFIRKSIEVDGTRIAFDPEADLIFDFDTLMPLHSNA
MRFRALAQDGAMLDERIFYSVGGGFVVAEGEPREPEPVEVPHPFATASELLSACARTGLT
IAGLQMANECVLRPAEEVEERLDAILAAMFASIDRGLAQEGTLPGSLRVRRRAKAIRDQL
EADRLANRRPPHEIMDWVSVFAMAVNEENAAGGRIVTAPTNGAAGIVPALLRYVRDICPD
TTHAQLRDFLLTAAAVGALIKRNASISGAEVGCQGEVGSAAAMAAAGLACVLGASPAQIE
NAAEIAMEHHLGMTCDPIGGLVQIPCIERNAFGANKAIAAASLALRGDGVHLVSLDQVIE
TMRQTGADMQSKYKETSQGGLAVNVPEC