Protein Info for GFF3430 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Alkanesulfonates transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 152 to 168 (17 residues), see Phobius details amino acids 200 to 211 (12 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 274 (171 residues), 89.9 bits, see alignment E=9.2e-30

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 49% identity to avi:Avi_7197)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>GFF3430 Alkanesulfonates transport system permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAALEHLAGGVGASPLPRAAAWPWRTALPAPLRRLLLALALPVAIVALWQWAAVQGWVPP
QILPAPALVWDTFLELARGGELLDGFLISLQRIGSGLALGGPLGLALGIWLGVSARARSH
LEPTLRALFAVPTLGWIPILILIFGIDEALKVIVIAKAVMVPVVLNTSRGIRNIPLAYLE
AARVLRLRPWTRLTRLTLPACLPTVFSGFRLGLSHAFIALIVVEMLAATEGIGYMMVWGR
KLFQLDIVIVGIVVVGVAGYALDLLLRRLERGLSRWAPEHG