Protein Info for GFF3429 in Xanthobacter sp. DMC5

Annotation: HTH-type transcriptional regulator CdhR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 68 to 205 (138 residues), 41.3 bits, see alignment E=2.1e-14 PF12833: HTH_18" amino acids 268 to 346 (79 residues), 80.3 bits, see alignment E=1.6e-26

Best Hits

KEGG orthology group: None (inferred from 74% identity to xau:Xaut_0872)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>GFF3429 HTH-type transcriptional regulator CdhR (Xanthobacter sp. DMC5)
MPAGGGARSTPCDFRLEQMRHVSTARPAPSAKLRVGFVLLPNFTLTAFSSFVDVLRLAGD
KGDRSRPIDCSWQVMSPHLRPARSSCGIDIQPTSDLMDPKGFDYIVVVGGLLRGVPARSD
PVGEYLKRAAAAGLPLIGVCTGSFLLCRLGLMAQRKCCVSWYHYRDFLDEFPTLVPVADQ
LFVVDGDRITCSGGAGVADLAARLVTEHLGAATAQKALNILLIDRPRAAESAQPAPRLAE
GTVDDARVSRALLMMEQNLAEPLAIADIADALGVGVRQLERLFADRLRESPQESYLALRL
RHARWMLANTRFSAARIAADLGFADGSHFGRAFKARFGATPAAFRRTVAPRSARSEGDGE
GRVFETP