Protein Info for PS417_17510 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 TIGR00229: PAS domain S-box protein" amino acids 99 to 223 (125 residues), 41.3 bits, see alignment E=7.6e-15 PF08448: PAS_4" amino acids 110 to 218 (109 residues), 90.1 bits, see alignment E=2.2e-29 PF00512: HisKA" amino acids 276 to 336 (61 residues), 38.4 bits, see alignment 2.2e-13 PF02518: HATPase_c" amino acids 381 to 490 (110 residues), 76.9 bits, see alignment E=3.4e-25 PF00072: Response_reg" amino acids 515 to 626 (112 residues), 39.6 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: None (inferred from 83% identity to ppg:PputGB1_3139)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UA75 at UniProt or InterPro

Protein Sequence (633 amino acids)

>PS417_17510 histidine kinase (Pseudomonas simiae WCS417)
MPEVGAELLAQVAQLQQDNHKLARINAALIERIESGMAQGNNPYTTFQHSVVLAEQVRER
TDALNQAMAELKASNHLLINARLRAETLRGEQVAAQKAQESERWIRLITDNVPALIGYLN
ADLVYEFTNKVYEEWYCWPRGMMLGQSLREVHSEQHCQRLDAYVARALAGESVTFEFAET
NINNQERYMLRSYVPNTLASGEVVGIFVLIRDITERRRTAEALHQAYQHLEQRVAQRTSE
LTALNDQLLQEIDERRRVEARLREAKLEAEQANLSKTKFLAAVSHDLLQPLNAARLFTSA
LLERPSETLVRNVSNSLEDVENLLGTLVDISKLDAGVIKADIAPFALSELLDNLAAEYTE
LARSEGLALHFVGCSALVRSDIQLLARILRNLLSNAIRYTYNGRVVLGCRRQHQRLLIQV
WDSGMGIAEERLEEIFQEFKRGDVQRPDQDRGLGLGLAIVEKIAGILGHRISVKSWPGKG
SMFSVEVPLSATAPKSLPILAMSEPMLERLQGARVWVLDNDAAICAGMRTLLEGWGCQVI
TALSEQDLARQVDNYHAEADLLIADYHLDDDQNGVDAVARINGRRGRAIPALMITANYSN
ELKQQIRELGHTLMHKPVRPMKLKTAMSHLLGK