Protein Info for GFF3417 in Xanthobacter sp. DMC5

Annotation: Oligopeptide transport ATP-binding protein OppD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF00005: ABC_tran" amino acids 21 to 184 (164 residues), 97.9 bits, see alignment E=7.9e-32 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 235 to 320 (86 residues), 63.3 bits, see alignment E=8.7e-22 PF08352: oligo_HPY" amino acids 235 to 302 (68 residues), 55.9 bits, see alignment E=4.5e-19

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 78% identity to azc:AZC_2662)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppD (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>GFF3417 Oligopeptide transport ATP-binding protein OppD (Xanthobacter sp. DMC5)
MAPLIDVRDLSIAFPRATPVRGLSLTVEAGETVALVGESGSGKSLTALALMRLLPDTARI
ASGEILFRGRDGGVTDLARLEDRALRRVRGRDIAMVFQEPMTSLNPVLSVGQQVAEVVRL
HEGLSRRAAFARAVELLDLVRIPEPRRRVGDYPHELSGGMRQRVMIAIAVACTPRLLIAD
EPTTALDVTIQAQVLDLLDALRRDLSMGLLLITHDLGVVAEWADRVAVMYAGRKVEDAPF
ETLFGAPLHPYTRGLLAASPRLDAGQHYSAGALAEIQGSIASAAGEEGCAFAPRCPSARA
LCRAGAPALEAVAPGHLVACPVTTAAAQREARHALAFG