Protein Info for PS417_17485 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03866: PQQ-dependent catabolism-associated beta-propeller protein" amino acids 11 to 319 (309 residues), 544.7 bits, see alignment E=5.5e-168 TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 23 to 57 (35 residues), 31.5 bits, see alignment 1.3e-11 amino acids 101 to 142 (42 residues), 40.5 bits, see alignment 2.1e-14 amino acids 277 to 318 (42 residues), 55.7 bits, see alignment 3.8e-19 PF21783: YNCE" amino acids 23 to 95 (73 residues), 30.7 bits, see alignment E=4.3e-11 amino acids 89 to 215 (127 residues), 27.2 bits, see alignment E=5.1e-10 amino acids 236 to 316 (81 residues), 28.5 bits, see alignment E=2e-10 PF02239: Cytochrom_D1" amino acids 66 to 162 (97 residues), 29.3 bits, see alignment E=6.5e-11

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfl:PFL_2208)

Predicted SEED Role

"FIG00443700: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBS3 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PS417_17485 membrane protein (Pseudomonas simiae WCS417)
MRRTLLSCALLLAAGHAVASTAWVSNEKDNSLSLIDMQTLQVTDTLKVGQRPRGLLLSHD
NKLLYICASDSDRVQVMDVATRKIIKELPSGKDPEQFALHPNNRWLYVSNEDDALVTVID
TETAKVLGQINVGVEPEGMAVSPDGKWAVNTSETTNMLHWIDTSTQTLADSTLVDQRPRF
VEFNHDGSQLWASAEIGGTVTILDVASRAILKTLTFSIKGVHPDKVQPVGIKLSADGKYG
FVALGPANHVAVIDAKTFEVLDYLLVGRRVWQMAFTPDEKQLLVTNGVSGDVSVIDVDSL
KVIKSVKVGRYPWGVVVTP