Protein Info for GFF3417 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG002903: a protein of unknown function perhaps involved in purine metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04356: DUF489
  • amino acids 7 to 199 (193 residues), 245.1 bits, E=2.9e-77

Best Hits

Swiss-Prot: 100% identical to HFLD_SALTY: High frequency lysogenization protein HflD homolog (hflD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07153, high frequency lysogenization protein (inferred from 98% identity to ses:SARI_01757)

Predicted SEED Role

"FIG002903: a protein of unknown function perhaps involved in purine metabolism"

Protein Sequence (213 amino acids)

>GFF3417 FIG002903: a protein of unknown function perhaps involved in purine metabolism (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VAKNYYDITLALSGICQSARLVQQLAHQGHCDADALHVSLNSVIDMNPSSTLGVFGGSEA
NLRLGLETLLGVLNASSRQGLNAELTRYTLSLMVLERKLSSAKGALNTLGDRINGLQRQL
DHFDLQSDTLMSAMAGIYVDVISPLGPRIQVTGSPAVLQSPQVQAKVRASLLAGIRAAVL
WHQVGGGRLQLMFSRHRLTTQAKQILAHLTPEL