Protein Info for GFF3416 in Xanthobacter sp. DMC5

Annotation: Oligopeptide transport ATP-binding protein OppF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF00005: ABC_tran" amino acids 24 to 174 (151 residues), 110.7 bits, see alignment E=1.3e-35 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 224 to 308 (85 residues), 88.9 bits, see alignment E=8.8e-30 PF08352: oligo_HPY" amino acids 226 to 289 (64 residues), 68.6 bits, see alignment E=7.3e-23

Best Hits

Swiss-Prot: 56% identical to Y4TS_SINFN: Probable peptide ABC transporter ATP-binding protein y4tS (NGR_a01400) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 73% identity to azc:AZC_2663)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>GFF3416 Oligopeptide transport ATP-binding protein OppF (Xanthobacter sp. DMC5)
MPLLSVENLHAGYESGGRLLRAVDGVSFAVEPGETVGLVGESGCGKSSLAKVIMRLVSPA
SGRVVFDGVDVGGLEGAPLKAYRRQAQIVFQDPFASLNPRQSIADILTAPLAVHGLVPRG
ERLKAAGDALERVGLPREALSRYPHEFSGGQRQRLGIARALILFPRLVICDEPVSALDLS
IQAQILNLLARLKAELGLSYLFISHDLSVVRYFADRVLVMYLGRIVETGSWQSIFARPLH
PYTRALIEAVPTPGRRRHAAPLSGDLPSARNVPTGCRFHPRCPLATPLCTQSDPALRPLG
AGRAVACHHAPEEALH