Protein Info for GFF3416 in Variovorax sp. SCN45

Annotation: Alkanesulfonates transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 76 to 97 (22 residues), see Phobius details amino acids 113 to 149 (37 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 253 (171 residues), 78.3 bits, see alignment E=3.2e-26

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_0102)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>GFF3416 Alkanesulfonates transport system permease protein (Variovorax sp. SCN45)
MKARPYLDRLGSLGVLLALVALWWVASNAGWVSRVFLPTPQATFASLLEGLNLSGTGGNG
ELLGFTQATVGRMIEGWLLASLFGVLLGAAIGVSPSVRAWVQPTLEFIRPLPASALLPLA
ISIFGLNPGMVLFVVAFGAMWPVLLATVHGFAAVEPRLSEVARCLQMSRAAYIWKMGLPN
AMPDILAGMRLALTIALIVAVVGEMIASQSGLGQAILLAARAFRASDLFAGIVLLGLIGF
ASNALLAFAEQRLLRWQHP