Protein Info for PS417_17420 in Pseudomonas simiae WCS417

Updated annotation (from data): ethanol oxidation regulatory protein ercA
Rationale: Strongest phenotype is on ethanol. Similar to ercA (PA1991) which apparently has a regulatory role (PMCID: PMC3754586) rather than being directly involved in catabolism. Consistent with a regulatory role, this gene has pleiotropic phenotypes. The main ethanol dehydrogenase is probably PS417_17460.
Original annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF00465: Fe-ADH" amino acids 14 to 181 (168 residues), 170.7 bits, see alignment E=3.3e-54 PF13685: Fe-ADH_2" amino acids 19 to 112 (94 residues), 40.5 bits, see alignment E=4.3e-14 PF25137: ADH_Fe_C" amino acids 193 to 386 (194 residues), 178.7 bits, see alignment E=1.7e-56

Best Hits

Swiss-Prot: 39% identical to DHAT_CITFR: 1,3-propanediol dehydrogenase (dhaT) from Citrobacter freundii

KEGG orthology group: None (inferred from 93% identity to ppu:PP_2682)

MetaCyc: 40% identical to alcohol dehydrogenase II monomer (Zymomonas mobilis)
Alcohol dehydrogenase. [EC: 1.1.1.1]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1); Acetaldehyde dehydrogenase (EC 1.2.1.10)" (EC 1.1.1.1, EC 1.2.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UDZ8 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PS417_17420 ethanol oxidation regulatory protein ercA (Pseudomonas simiae WCS417)
MSPNLSLLRKFVSPEIIFGAGCRHNVGNYAKTFGARKVLVVSDPGVIAAGWVADVEASLQ
AIGIDYCLYSAVSPNPRVEEVMLGAEVYRENHCDVIVAIGGGSPMDCGKAIGIVVAHGRC
ILEFEGVDTIRVPSPPLILIPTTAGTSADVSQFVIISNQQERMKFSIVSKAVVPDVSLID
PETTASMDPFLSACTGIDALVHAIEAFVSTGHGPLTDPHALEAMRLINGNLVQMIANPGD
IALREKIMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYNSA
PERFKVIAETFGIDCRGLSHRQVCARLVEHLIALKHAIGFHETLGLHGVRVADIPFLSRH
AMHDPCILTNPRESSQRDVEVVYGEAL