Protein Info for GFF3402 in Sphingobium sp. HT1-2

Annotation: Tetrapartite efflux system, inner membrane component FusBC-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 36 to 53 (18 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 110 to 136 (27 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details PF04632: FUSC" amino acids 11 to 312 (302 residues), 321.1 bits, see alignment E=2.6e-99 PF13515: FUSC_2" amino acids 24 to 154 (131 residues), 49.3 bits, see alignment E=8.1e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>GFF3402 Tetrapartite efflux system, inner membrane component FusBC-like (Sphingobium sp. HT1-2)
MTFTKLGGNDALFTLKAFLSAIMAYYIALRIGLERPYWAIITSYIVAQPLAGAVSSKAIF
RLFGTVVGALVAIVLVPTLGNVPELLCLALAAWLGLCTYVALLDRTPRAYTFLLAGYTAG
IIALPTVDVPATIFTVASLRTQEIAIGIISATLVHSLVFPRTVSARMMARIDVILADAER
WTRDSLTHQQSDVLVARDRRQLATDIHELHQLSAHLPFESSRHRLKAGMLRALETQLCLL
LPLASAVEDRVQQLQVNGGLPSPVKELLEDAVLWLAGAEQGCTMSEVDILRRRARACEPD
CAKFVPWKAVLISTEK