Protein Info for GFF34 in Xanthobacter sp. DMC5

Annotation: (2R)-3-sulfolactate dehydrogenase (NADP(+))

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF02615: Ldh_2" amino acids 13 to 336 (324 residues), 321.5 bits, see alignment E=3.1e-100

Best Hits

Swiss-Prot: 40% identical to PY2CR_PSEAE: Delta(1)-pyrroline-2-carboxylate/Delta(1)-piperideine-2-carboxylate reductase (lhpD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 83% identity to azc:AZC_1795)

Predicted SEED Role

"Ureidoglycolate dehydrogenase (EC 1.1.1.154)" in subsystem Allantoin Utilization (EC 1.1.1.154)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.154

Use Curated BLAST to search for 1.1.1.154

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>GFF34 (2R)-3-sulfolactate dehydrogenase (NADP(+)) (Xanthobacter sp. DMC5)
VSAQPSVPMVSLSLKQVEDLTFRALIACRVSPANALSVTASVVAAEAEGVHSHGLARLPT
YCAHAKVGKIDGHATPDLTRPRPGLVRVDAQDGFAHPAIDLGLPALVAAAKAQGIAALAV
TNSYNCGVVGYHVERIARAGLMALGFVNAPASIAPVGGTRPVFGTNPVAFAVPRAGEDPL
VLDQSSSVIAKSEIVVHQQRGQKIPLGWALDRKGQPTDDPAAALDGGTMVPSGGHKGAGL
ALIVELFAAWITGANLSIDASSFADNAGGSPRTGQFFIAVDPGPLAGPDAAARLVHLFAA
IVEQEGARLPGTRRAAARRLTAEAGVRIPAALKDRLDAIAAGA