Protein Info for PS417_17395 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 32 to 58 (27 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 221 to 245 (25 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details amino acids 415 to 440 (26 residues), see Phobius details amino acids 508 to 525 (18 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 434 (395 residues), 54.2 bits, see alignment E=6e-19

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU3956)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8N5 at UniProt or InterPro

Protein Sequence (547 amino acids)

>PS417_17395 MFS transporter (Pseudomonas simiae WCS417)
MDKYTPHTWEPHERPSLPGSPSTPWHPTHKRWLYALVGVLVAITGGLGNALVIANLQYLQ
GALGATTAEMAWLPAAYVMTNVCMNLLLVKFRQQFGLRAFTEVFLVLYALVTFGHLFVND
LNSAIAVRAAHGMVGAALSSLGLYYMIQAFPAKWRLKSLVLGLGTAQLALPLARLFSEDL
LQIAEWRGLYLFELGMALICLGCVFLLKLPPGDRFKTFEKLDFLTFAILASGVALLCAVL
SLGRIDWWLEAPWIGIASACSLVLIMAGLAIEHNRANPMLMTRWLGSGVMIRLALAVILI
RMVLSEQSTGAVGFMQMLNMSYQQMHTLYVVMLAGAIAGLVVSALTINPAHLLMPLVISL
ALMAIGSVMDSFSSNLTRPQNLYISQFLLGFGGTFFLGPTMVLGTKNVLTNPRNLVSFSV
MFGICQNLGGLIGAALLGTFQIVREKYHSSMIVEHLTLLDPRVAARVQSGGSAYGGIVAD
PELRNLMGIRSLATAATREANVMAYNDVFMLIAIIAILTMIWIFIRSLWLMSTTKAATPV
QPSGAPS