Protein Info for PS417_17390 in Pseudomonas simiae WCS417

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details PF25917: BSH_RND" amino acids 81 to 274 (194 residues), 44.1 bits, see alignment E=4.7e-15 PF25876: HH_MFP_RND" amino acids 150 to 213 (64 residues), 29.9 bits, see alignment E=1.6e-10 PF25954: Beta-barrel_RND_2" amino acids 277 to 321 (45 residues), 33.7 bits, see alignment 1.1e-11 PF25963: Beta-barrel_AAEA" amino acids 278 to 370 (93 residues), 36.5 bits, see alignment E=1.3e-12 PF25990: Beta-barrel_YknX" amino acids 280 to 370 (91 residues), 34 bits, see alignment E=9.1e-12

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU3955)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0Z7 at UniProt or InterPro

Protein Sequence (381 amino acids)

>PS417_17390 DSBA oxidoreductase (Pseudomonas simiae WCS417)
MTESTTTTTNAIAATPEGTTPPGATVTEPRSLRVRILSSLGFAAIAIVGVLIVLYAWQLP
PFSSAVETTENALVRGQVTIIGPQLSGYVFEVPVQDFQYVKAGDLLVRLDDRIYKQRLDQ
ALAQLAVQKAALANVVQQRNSAEATIKLRQAALADSQAQARKSTADLRRNEELISDGSVS
KRELDVTRAANAQTIAAVAQAQASLEIARQDLQTVIVNRGSLEAAVASAEAAVELARIDL
SNTRITAPRDGQLGQIGVRLGAYVNSGAQLMALVPPQLWVIANMKETQMDNVQVGQPVTF
TVDALNHRKFHGTVQHISPATGSEFSLLQADNATGNFVKIAQRVPVRITVDPDQAESERL
RPGLSVVVSIDTAGRLKNSPP