Protein Info for GFF3398 in Sphingobium sp. HT1-2

Annotation: L-lactate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 119 to 153 (35 residues), see Phobius details amino acids 157 to 194 (38 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 229 to 243 (15 residues), see Phobius details amino acids 255 to 272 (18 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details amino acids 445 to 463 (19 residues), see Phobius details amino acids 533 to 554 (22 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 9 to 548 (540 residues), 694 bits, see alignment E=7.6e-213 PF02652: Lactate_perm" amino acids 19 to 545 (527 residues), 670.6 bits, see alignment E=8.7e-206

Best Hits

KEGG orthology group: K00427, L-lactate permease (inferred from 72% identity to rva:Rvan_0888)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (555 amino acids)

>GFF3398 L-lactate permease (Sphingobium sp. HT1-2)
VQTATTWSQTYDPLGNLWLSGLVAAIPILFFFAALTVLKLKGHVAGTITLLLAMAVAVTV
FGMPAGMALAAAIYGFCYGLWPIAWIIVGAVFLYKVSVETGQFAIIRRSILAITQDQRLQ
LLLVGFAFGAFLEGAAGFGAPIAITAALLVGLGFKPLHAAGLCLIANAAPVAYGAMGIPI
IVAGEVTGIGPFAIGQMAGRQLPLLALLIPFWLVFVMDGMRGVRETWPAVLVAGGSFATV
QSLTANHVGPELPDILAGLATLICLPLFLRFWKPARVFRFEDAGEAGMALPAQDAAPVTR
GQVVRAWSPFLILTAFVTLWSVAPFKRLFAPDGPLSSMVAHVSVPLLDGRVLKGPPIAAQ
ATPFPADYKFDWFSGTGTAIFIAALVTLLVLGLRPRRALVTFAATVRGLLVPIYSIGTVL
AFAFVANYSGLSATLALPLAQTGRAFTFFSPFLGWLGVFLTGSDTSANALFGALQATTAR
QIGVSDVLLVSVNTTGGGTGKMISPQSIAIACGAVGLVGRESALFRFTVKHSLLFAALIG
VLTTVQAYMLPWMIP