Protein Info for GFF3395 in Variovorax sp. SCN45

Annotation: Benzoate ABC transporter, permease protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 17 to 22 (6 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 242 to 267 (26 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 27 to 293 (267 residues), 149.2 bits, see alignment E=6.5e-48

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 93% identity to vap:Vapar_0085)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator precursor" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>GFF3395 Benzoate ABC transporter, permease protein 2 (Variovorax sp. SCN45)
MKKSAFLVPVICAVAIGVAGPLMGNYMSDFVVKIMILSIFALSLELLVGMTGLVSLGHAA
FYGIGAYVTVLASGSEGGNFALLLPLAMGAAALYALFVGALSLRTRGVYFIMVTLAFAQM
AFFVFHDTKVGGGSDGIYMYVRPALGALDLENRTVLFYVVLASLVFTYGLLALIRRSRFG
AALAGIRVNEQRMRAAGFSVYGYKLAAFVLAGALAGLAGFLLASRDGVVNPELMAWHNSG
EVLLMVILGGLGHLRGAVIGAIAFTLLKEIFSTHAVMGPLADHWQLTLGLTIIVFVALLP
KGLIGLVQRLSPKGAA